PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01023137001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 169aa    MW: 18103.3 Da    PI: 8.3218
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01023137001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.42.6e-3171126258
        ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                        ++vrY+eClkNhAa++Gg+a+DGCgEfmp  geegt +al+C+AC CHRnFHR+eve
  GSVIVT01023137001  71 KAVRYRECLKNHAAAMGGNATDGCGEFMPG-GEEGTLEALNCSACHCHRNFHRKEVE 126
                        689**************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.1E-2873125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-2373127IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-2974125IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.20775124IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MELTSQEGEI PIPINSAYGG GGGHGHGHGH GHMIHHDPAP HNHIIHSSAP QIPSNGPPIP  60
STLEDHVPYK KAVRYRECLK NHAAAMGGNA TDGCGEFMPG GEEGTLEALN CSACHCHRNF  120
HRKEVEALQR KLVGKFRSKK KLWCNSSAKR LVSKDESSRS GCTTTSTT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.198630.0inflorescence
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4361180.0AM436118.2 Vitis vinifera contig VV78X172274.5, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003633412.15e-89PREDICTED: zinc-finger homeodomain protein 4
SwissprotQ9M9S04e-34ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLF6HJZ65e-89F6HJZ6_VITVI; Putative uncharacterized protein
STRINGVIT_12s0035g01880.t011e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-31homeobox protein 31